Loading...
Statistics
Advertisement

Cogip.biz
www.cogip.biz/

Cogip.biz

Advertisement
Conversion Technology Metas Server
Cogip.biz is hosted in France . Cogip.biz uses HTTPS protocol. Number of used technologies: 2. First technologies: Html, Iframe, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Apache/2.4.6 (CentOS) OpenSSL/1.0.1e-fips mod_fcgid/2.3.9 PHP/5.4.16 mod_perl/2.0.9dev Perl/v5.16.3.

Technologies in use by Cogip.biz

Technology

Number of occurences: 2
  • Html
  • Iframe

Advertisement

Server Type

  • Apache/2.4.6 (CentOS) OpenSSL/1.0.1e-fips mod_fcgid/2.3.9 PHP/5.4.16 mod_perl/2.0.9dev Perl/v5.16.3

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Cogip.biz

SSL certificate

    • name: /C=--/ST=SomeState/L=SomeCity/O=SomeOrganization/OU=SomeOrganizationalUnit/CN=ns368515.ip-37-187-171.eu/emailAddress=root@ns368515.ip-37-187-171.eu
    • subject:
      • C: --
      • ST: SomeState
      • L: SomeCity
      • O: SomeOrganization
      • OU: SomeOrganizationalUnit
      • CN: ns368515.ip-37-187-171.eu
      • emailAddress: root@ns368515.ip-37-187-171.eu
    • hash: f26a76c1
    • issuer:
      • C: --
      • ST: SomeState
      • L: SomeCity
      • O: SomeOrganization
      • OU: SomeOrganizationalUnit
      • CN: ns368515.ip-37-187-171.eu
      • emailAddress: root@ns368515.ip-37-187-171.eu
    • version: 2
    • serialNumber: 2334
    • validFrom: 150202140616Z
    • validTo: 160202140616Z
    • validFrom_time_t: 1422885976
    • validTo_time_t: 1454421976
    • extensions:
      • basicConstraints: CA:FALSE
      • keyUsage: Digital Signature, Non Repudiation, Key Encipherment

Meta - Cogip.biz

Number of occurences: 0

Server / Hosting

  • IP: 37.187.171.164
  • Latitude: 48.86
  • Longitude: 2.34
  • Country: France

Rname

  • ns109.ovh.net
  • dns109.ovh.net
  • hebergement-entreprise.e-tera.com

Target

  • tech.ovh.net

HTTP Header Response

HTTP/1.1 200 OK Date: Wed, 20 Jul 2016 14:12:02 GMT Server: Apache/2.4.6 (CentOS) OpenSSL/1.0.1e-fips mod_fcgid/2.3.9 PHP/5.4.16 mod_perl/2.0.9dev Perl/v5.16.3 Last-Modified: Wed, 11 Mar 2015 11:09:19 GMT ETag: "dd-511014c7c5472" Accept-Ranges: bytes Content-Length: 221 Content-Type: text/html; charset=UTF-8 X-Cache: MISS from s_sr109 X-Cache-Lookup: MISS from s_sr109:80 Via: 1.1 s_sr109 (squid/3.5.14) Connection: keep-alive

DNS

host: cogip.biz
  1. class: IN
  2. ttl: 3600
  3. type: A
  4. ip: 37.187.171.164
host: cogip.biz
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns109.ovh.net
host: cogip.biz
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: dns109.ovh.net
host: cogip.biz
  1. class: IN
  2. ttl: 3600
  3. type: SOA
  4. mname: dns109.ovh.net
  5. rname: tech.ovh.net
  6. serial: 2016062400
  7. refresh: 86400
  8. retry: 3600
  9. expire: 3600000
  10. minimum-ttl: 300
host: cogip.biz
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 5
  5. target: hebergement-entreprise.e-tera.com
host: cogip.biz
  1. class: IN
  2. ttl: 3600
  3. type: TXT
  4. txt: 1|www.cogip.biz
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.ogip.biz, www.cdogip.biz, www.dogip.biz, www.crogip.biz, www.rogip.biz, www.ctogip.biz, www.togip.biz, www.cvogip.biz, www.vogip.biz, www.cfogip.biz, www.fogip.biz, www.cgogip.biz, www.gogip.biz, www.chogip.biz, www.hogip.biz, www.cnogip.biz, www.nogip.biz, www.cmogip.biz, www.mogip.biz, www.cjogip.biz, www.jogip.biz, www.cgip.biz, www.cobgip.biz, www.cbgip.biz, www.cohgip.biz, www.chgip.biz, www.coggip.biz, www.cggip.biz, www.cojgip.biz, www.cjgip.biz, www.comgip.biz, www.cmgip.biz, www.co gip.biz, www.c gip.biz, www.covgip.biz, www.cvgip.biz, www.coip.biz, www.cogsip.biz, www.cosip.biz, www.cogxip.biz, www.coxip.biz, www.cogyip.biz, www.coyip.biz, www.coghip.biz, www.cohip.biz, www.cognip.biz, www.conip.biz, www.cogcip.biz, www.cocip.biz, www.cogdip.biz, www.codip.biz, www.cogeip.biz, www.coeip.biz, www.cogrip.biz, www.corip.biz, www.cogtip.biz, www.cotip.biz, www.cogbip.biz, www.cobip.biz, www.cogvip.biz, www.covip.biz, www.cogp.biz, www.cogirp.biz, www.cogrp.biz, www.cogifp.biz, www.cogfp.biz, www.cogivp.biz, www.cogvp.biz, www.cogikp.biz, www.cogkp.biz, www.cogi,p.biz, www.cog,p.biz, www.cogibp.biz, www.cogbp.biz, www.cogigp.biz, www.coggp.biz, www.cogitp.biz, www.cogtp.biz, www.cogiyp.biz, www.cogyp.biz, www.cogiup.biz, www.cogup.biz, www.cogijp.biz, www.cogjp.biz, www.cogimp.biz, www.cogmp.biz, www.coginp.biz, www.cognp.biz, www.cogi.biz, www.cogipi.biz, www.cogii.biz, www.cogipk.biz, www.cogik.biz, www.cogipu.biz, www.cogiu.biz, www.cogipj.biz, www.cogij.biz, www.cogipl.biz, www.cogil.biz,

Other websites we recently analyzed

  1. kiptom.com
    Brea (United States) - 75.119.203.215
    Server software: Apache
    Technology: CSS
  2. kineticwave.com
    Switzerland - 141.8.225.31
    Server software: Apache
    Technology: Html
  3. Clean Meals - Hoe gezond eet jij?
    Wij hebben de oplossing als je makkelijk en gezond wil eten: Clean Meals, heerlijke ready-made maaltijden in optimale samenstelling qua voedingswaarden.
    United Kingdom - 78.136.17.171
    G Analytics ID: UA-72057542-1
    Server software:
    Technology: BootstrapCDN, CSS, Datepicker, Flexslider, Font Awesome, Google Font API, Html, Html5, Iframe, Javascript, jQuery, jQuery UI, Php, Pingback, Revslider, SVG, Google Analytics, Google Tagmanager, Visual Website Optimizer, Wordpress
    Number of Javascript: 35
    Number of meta tags: 9
  4. Lovely Jane macht Pause
    Germany - 85.13.136.199
    Server software: Apache
    Technology: CSS, Html
    Number of meta tags: 1
  5. huntingfishingcampinggearreviews.com
    Houston (United States) - 192.185.4.67
    Server software: nginx/1.10.1
    Technology: Html
    Number of meta tags: 2
  6. wherefarminggrows.com
    Scottsdale (United States) - 184.168.221.36
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  7. Britta Mangold . director of photography
    Dies ist die private Webseite von Britta Mangold
    Germany - 82.165.58.15
    Server software: Apache/1.3.33 (Debian GNU/Linux) FrontPage/5.0.2.2635 DAV/1.0.3 mod_python/2.7.10 Python/2.3.4 mod_gzip/1.3.26.1a PHP/4.3.10-18 mod_ssl/2.8.22 OpenSSL/0.9.7e mod_perl/1.29 mod_chroot/0.4
    Technology: CSS, Html, Javascript
    Number of Javascript: 5
    Number of meta tags: 4
  8. certifymybiz.com
    Scottsdale (United States) - 184.168.221.37
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  9. hajarbuncit.com
    Singapore (Singapore) - 54.251.110.33
    Server software: nginx/1.6.2
    Technology: Html
  10. ACKERMANN Hausverwaltung in München - Immobilienmanagement seit 1919
    Die Ackermann Hausverwaltung in München leistet die Verwaltung von Mietshäusern und Wohneigentum, bietet Asset Management, Projektentwicklung sowie Verkauf und Vermietung von Immobilien.
    Germany - 46.252.18.246
    G Analytics ID: UA-56769375-6
    Server software: Apache/2.4.10
    Technology: CSS, Html, Javascript, Php, Google Analytics
    Number of Javascript: 14
    Number of meta tags: 4

Check Other Websites